Claim your business

Is your business on Mercoly?

Mercoly lists businesses across the U.S. from public data. Claim yours to take control — edit your info, add what you sell, set your policies, and connect with customers. It's free.

A

Advance Chimney

Hyannis, MA · view listing

It's free

Claiming and managing your listing costs nothing.

Sell more

List products & services and take inquiries and orders.

Customer messages

Messages customers send your page are delivered to you.

Stay in control

Edit details, set your policies, or request removal anytime.

Start your claim

Verify instantly with an email at your business's own website domain — or request a manual review.

Instant verification available

This listing can be claimed in about a minute with an email @advancechimneysweepandrepairs.com. Create a free account (or sign in) to start — you’ll come right back here.

Prefer a manual review?

If you can’t receive email @advancechimneysweepandrepairs.com, send a request and our team will verify you another way.

By submitting, you confirm you’re authorized to act for this business. We verify requests before making changes.

Don’t want your business listed? Request removal instead. Questions? Email support@mercoly.com.