Claim your business
Is your business on Mercoly?
Mercoly lists businesses across the U.S. from public data. Claim yours to take control — edit your info, add what you sell, set your policies, and connect with customers. It's free.
McNeil Veterinary Services
Ventura, CA · view listing
It's free
Claiming and managing your listing costs nothing.
Sell more
List products & services and take inquiries and orders.
Customer messages
Messages customers send your page are delivered to you.
Stay in control
Edit details, set your policies, or request removal anytime.
Start your claim
Verify instantly with an email at your business's own website domain — or request a manual review.
Instant verification available
This listing can be claimed in about a minute with an email @mcneilveterinaryservices.placeweb.site. Create a free account (or sign in) to start — you’ll come right back here.
Prefer a manual review?
If you can’t receive email @mcneilveterinaryservices.placeweb.site, send a request and our team will verify you another way.
Don’t want your business listed? Request removal instead. Questions? Email support@mercoly.com.